• Education
    • Higher Education
    • Scholarships & Grants
    • Online Learning
    • School Reforms
    • Research & Innovation
  • Lifestyle
    • Travel
    • Food & Drink
    • Fashion & Beauty
    • Home & Living
    • Relationships & Family
  • Technology & Startups
    • Software & Apps
    • Startup Success Stories
    • Startups & Innovations
    • Tech Regulations
    • Venture Capital
    • Artificial Intelligence
    • Cybersecurity
    • Emerging Technologies
    • Gadgets & Devices
    • Industry Analysis
  • About us
  • Contact
  • Advertise with Us
  • Privacy & Policy
Today Headline
  • Home
  • World News
    • Us & Canada
    • Europe
    • Asia
    • Africa
    • Middle East
  • Politics
    • Elections
    • Political Parties
    • Government Policies
    • International Relations
    • Legislative News
  • Business & Finance
    • Market Trends
    • Stock Market
    • Entrepreneurship
    • Corporate News
    • Economic Policies
  • Science & Environment
    • Space Exploration
    • Climate Change
    • Wildlife & Conservation
    • Environmental Policies
    • Medical Research
  • Health
    • Public Health
    • Mental Health
    • Medical Breakthroughs
    • Fitness & Nutrition
    • Pandemic Updates
  • Sports
    • Football
    • Basketball
    • Tennis
    • Olympics
    • Motorsport
  • Entertainment
    • Movies
    • Music
    • TV & Streaming
    • Celebrity News
    • Awards & Festivals
  • Crime & Justice
    • Court Cases
    • Cybercrime
    • Policing
    • Criminal Investigations
    • Legal Reforms
No Result
View All Result
  • Home
  • World News
    • Us & Canada
    • Europe
    • Asia
    • Africa
    • Middle East
  • Politics
    • Elections
    • Political Parties
    • Government Policies
    • International Relations
    • Legislative News
  • Business & Finance
    • Market Trends
    • Stock Market
    • Entrepreneurship
    • Corporate News
    • Economic Policies
  • Science & Environment
    • Space Exploration
    • Climate Change
    • Wildlife & Conservation
    • Environmental Policies
    • Medical Research
  • Health
    • Public Health
    • Mental Health
    • Medical Breakthroughs
    • Fitness & Nutrition
    • Pandemic Updates
  • Sports
    • Football
    • Basketball
    • Tennis
    • Olympics
    • Motorsport
  • Entertainment
    • Movies
    • Music
    • TV & Streaming
    • Celebrity News
    • Awards & Festivals
  • Crime & Justice
    • Court Cases
    • Cybercrime
    • Policing
    • Criminal Investigations
    • Legal Reforms
No Result
View All Result
Today Headline
No Result
View All Result
Home Business & Finance Economic Policies

‘System cracks’: Treasury head ripped for dismissing consumer concerns over ’empty shelves’ todayheadline

April 28, 2025
in Economic Policies
Reading Time: 2 mins read
A A
0
'A lot of uncertainty': MAGA senator accuses Trump officials of being 'inconsistent' on key issue
7
SHARES
15
VIEWS
Share on FacebookShare on Twitter

Treasury Secretary Scott Bessent is facing criticism online after stating that he is not concerned about empty shelves resulting from President Trump’s controversial tariff policy because he assumes that retailers “preordered.”

“Are you worried about empty shelves,” Bessant was asked by Fox News’ “Fox and Friends” on Monday.

“Not at present. We have some great retailers. I assume they preordered,” he responded.

ALSO READ: ‘Remake entire US economic order’: Trump won’t ‘back down’ CNBC host predicts

Social media users were surprised by the secretary’s response.

User @Hannibal999 wrote:“If you’re leading Treasury, you should know the status of critical imports and supplies, not ‘assume.’ Hope is not a supply chain strategy. Assumptions don’t fill shelves when the system cracks.”

Another user @DonMcGowan said, “Is he trying to say that retailers had the foresight to mass over-order before Trump came in and destroyed trade links across the world? Trump made the decisions in one day. Then made it worse, two days later.”

Author Stephanie Kelton wrote, “‘Prices are steady right now,’ the big box CEOs told the president, but ‘the shelves will be empty’ and this ‘could become noticeable in two weeks.'”

ALSO READ: ‘Shelves will be empty’: How CEOs of US’ 3 largest retailers convinced Trump to reverse economic policy

User @KanKansi wrote, “What are they going to say when the shelves are empty?”

An account @LiveOnTheChat wrote, “‘We will see how quickly the Chinese want to deescalate.’ Xi is in no rush to negotiate. Expect empty shelves for months. These people have no f—–g idea what they are doing.”

The National Retail Federation thinks U.S. imports will plunge by at least 20 percent in the second half of 2025 if increased tariffs are not reversed.

“Shortages are a real possibility,” Coresight Research analyst John Harmon told Axios last week.

ALSO READ: CEOs warning Trump’s tariffs may cause ’empty shelves’ at retail — here’s when it might happen

Tags: concernsConsumercracksdismissingemptyrippedshelvessystemtodayheadlineTreasury
Previous Post

Hunger-dependent female receptivity leads to variable optimal polyandry with equal fitness in a nuptial gift-giving spider todayheadline

Next Post

Jeff Bezos Backed Slate Auto Reveals First Affordable Truck todayheadline

Related Posts

ET logo

Trump tariffs power India’s swadeshi drive todayheadline

August 4, 2025
6

Sri Lanka offers driving license for tourists on arrival at Rs2,000 todayheadline

August 4, 2025
8
Next Post
Jeff Bezos Backed Slate Auto Reveals First Affordable Truck

Jeff Bezos Backed Slate Auto Reveals First Affordable Truck todayheadline

  • Trending
  • Comments
  • Latest
Family calls for change after B.C. nurse dies by suicide after attacks on the job

Family calls for change after B.C. nurse dies by suicide after attacks on the job

April 2, 2025
Pioneering 3D printing project shares successes

Product reduces TPH levels to non-hazardous status

November 27, 2024

Police ID man who died after Corso Italia fight

December 23, 2024

Hospital Mergers Fail to Deliver Better Care or Lower Costs, Study Finds todayheadline

December 31, 2024
Harris tells supporters 'never give up' and urges peaceful transfer of power

Harris tells supporters ‘never give up’ and urges peaceful transfer of power

0
Des Moines Man Accused Of Shooting Ex-Girlfriend's Mother

Des Moines Man Accused Of Shooting Ex-Girlfriend’s Mother

0

Trump ‘looks forward’ to White House meeting with Biden

0
Catholic voters were critical to Donald Trump’s blowout victory: ‘Harris snubbed us’

Catholic voters were critical to Donald Trump’s blowout victory: ‘Harris snubbed us’

0

Mark Cavanaugh: Integrating Safety into the Orion Spacecraft 

August 4, 2025
psychedelic

Psychedelics and non-hallucinogenic analogs work through the same receptor—up to a point

August 4, 2025
An osprey flaps its wings atop a tufa at Mono Lake.

Calls grow for boosting Mono Lake by easing L.A.’s water reliance

August 4, 2025
Taiwan family of 5 perish in landslide; son survives after staying home to care for grandpa

Taiwan family of 5 perish in landslide; son survives after staying home to care for grandpa

August 4, 2025

Recent News

Mark Cavanaugh: Integrating Safety into the Orion Spacecraft 

August 4, 2025
6
psychedelic

Psychedelics and non-hallucinogenic analogs work through the same receptor—up to a point

August 4, 2025
3
An osprey flaps its wings atop a tufa at Mono Lake.

Calls grow for boosting Mono Lake by easing L.A.’s water reliance

August 4, 2025
4
Taiwan family of 5 perish in landslide; son survives after staying home to care for grandpa

Taiwan family of 5 perish in landslide; son survives after staying home to care for grandpa

August 4, 2025
6

TodayHeadline is a dynamic news website dedicated to delivering up-to-date and comprehensive news coverage from around the globe.

Follow Us

Browse by Category

  • Africa
  • Asia
  • Basketball
  • Business & Finance
  • Climate Change
  • Crime & Justice
  • Cybersecurity
  • Economic Policies
  • Elections
  • Entertainment
  • Entrepreneurship
  • Environmental Policies
  • Europe
  • Football
  • Gadgets & Devices
  • Health
  • Medical Research
  • Mental Health
  • Middle East
  • Motorsport
  • Olympics
  • Politics
  • Public Health
  • Relationships & Family
  • Science & Environment
  • Software & Apps
  • Space Exploration
  • Sports
  • Stock Market
  • Technology & Startups
  • Tennis
  • Travel
  • Uncategorized
  • Us & Canada
  • Wildlife & Conservation
  • World News

Recent News

Mark Cavanaugh: Integrating Safety into the Orion Spacecraft 

August 4, 2025
psychedelic

Psychedelics and non-hallucinogenic analogs work through the same receptor—up to a point

August 4, 2025
  • Education
  • Lifestyle
  • Technology & Startups
  • About us
  • Contact
  • Advertise with Us
  • Privacy & Policy

© 2024 Todayheadline.co

Welcome Back!

OR

Login to your account below

Forgotten Password?

Retrieve your password

Please enter your username or email address to reset your password.

Log In
No Result
View All Result
  • Business & Finance
  • Corporate News
  • Economic Policies
  • Entrepreneurship
  • Market Trends
  • Crime & Justice
  • Court Cases
  • Criminal Investigations
  • Cybercrime
  • Legal Reforms
  • Policing
  • Education
  • Higher Education
  • Online Learning
  • Entertainment
  • Awards & Festivals
  • Celebrity News
  • Movies
  • Music
  • Health
  • Fitness & Nutrition
  • Medical Breakthroughs
  • Mental Health
  • Pandemic Updates
  • Lifestyle
  • Fashion & Beauty
  • Food & Drink
  • Home & Living
  • Politics
  • Elections
  • Government Policies
  • International Relations
  • Legislative News
  • Political Parties
  • Africa
  • Asia
  • Europe
  • Middle East
  • Artificial Intelligence
  • Cybersecurity
  • Emerging Technologies
  • Gadgets & Devices
  • Industry Analysis
  • Basketball
  • Football
  • Motorsport
  • Olympics
  • Climate Change
  • Environmental Policies
  • Medical Research
  • Science & Environment
  • Space Exploration
  • Wildlife & Conservation
  • Sports
  • Tennis
  • Technology & Startups
  • Software & Apps
  • Startup Success Stories
  • Startups & Innovations
  • Tech Regulations
  • Venture Capital
  • Uncategorized
  • World News
  • Us & Canada
  • Public Health
  • Relationships & Family
  • Travel
  • Research & Innovation
  • Scholarships & Grants
  • School Reforms
  • Stock Market
  • TV & Streaming
  • Advertise with Us
  • Privacy & Policy
  • About us
  • Contact

© 2024 Todayheadline.co